Lineage for d1uhua1 (1uhu A:7-98)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1999823Fold a.61: Retroviral matrix proteins [47835] (1 superfamily)
    4-5 helices; right-handed superhelix
  4. 1999824Superfamily a.61.1: Retroviral matrix proteins [47836] (6 families) (S)
    the 5th, C-terminal helix is missing in some of the member structures
  5. 1999880Family a.61.1.6: MMLV matrix protein-like [81803] (2 protein domains)
    automatically mapped to Pfam PF01140
  6. 1999887Protein Product of RIKEN cDNA 3110009e22 [109876] (1 species)
  7. 1999888Species Unclassified, murine endogenous retrovirus [TaxId:12908] [109877] (1 PDB entry)
    Uniprot O62708 7-98 # 73% sequence identity
  8. 1999889Domain d1uhua1: 1uhu A:7-98 [107854]
    Other proteins in same PDB: d1uhua2, d1uhua3
    Structural genomics target

Details for d1uhua1

PDB Entry: 1uhu (more details)

PDB Description: Solution structure of the retroviral Gag MA-like domain of RIKEN cDNA 3110009E22
PDB Compounds: (A:) product of RIKEN cDNA 3110009E22

SCOPe Domain Sequences for d1uhua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uhua1 a.61.1.6 (A:7-98) Product of RIKEN cDNA 3110009e22 {Unclassified, murine endogenous retrovirus [TaxId: 12908]}
tplsltldhwseirsrahnlsveikkgpwrtfcasewptfdvgwppegtfdltvifevka
ivfqdgpgshpdqqpyitvwqdlvqnsppwik

SCOPe Domain Coordinates for d1uhua1:

Click to download the PDB-style file with coordinates for d1uhua1.
(The format of our PDB-style files is described here.)

Timeline for d1uhua1: