Lineage for d1uhsa1 (1uhs A:9-72)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2305223Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 2305224Family a.4.1.1: Homeodomain [46690] (41 proteins)
    Pfam PF00046
  6. 2305307Protein Homeodomain-only protein, Hop [109647] (1 species)
  7. 2305308Species Mouse (Mus musculus) [TaxId:10090] [109648] (1 PDB entry)
    Uniprot Q8R1H0
  8. 2305309Domain d1uhsa1: 1uhs A:9-72 [107853]
    Other proteins in same PDB: d1uhsa2

Details for d1uhsa1

PDB Entry: 1uhs (more details)

PDB Description: solution structure of mouse homeodomain-only protein hop
PDB Compounds: (A:) homeodomain only protein

SCOPe Domain Sequences for d1uhsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uhsa1 a.4.1.1 (A:9-72) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]}
tedqveileynfnkvnkhpdpttlcliaaeaglteeqtqkwfkqrlaewrrseglpsecr
svtd

SCOPe Domain Coordinates for d1uhsa1:

Click to download the PDB-style file with coordinates for d1uhsa1.
(The format of our PDB-style files is described here.)

Timeline for d1uhsa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1uhsa2