Class a: All alpha proteins [46456] (289 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (20 families) consists only of helices |
Family a.4.1.1: Homeodomain [46690] (41 proteins) Pfam PF00046 |
Protein Homeodomain-only protein, Hop [109647] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [109648] (1 PDB entry) Uniprot Q8R1H0 |
Domain d1uhsa1: 1uhs A:9-72 [107853] Other proteins in same PDB: d1uhsa2 |
PDB Entry: 1uhs (more details)
SCOPe Domain Sequences for d1uhsa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uhsa1 a.4.1.1 (A:9-72) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} tedqveileynfnkvnkhpdpttlcliaaeaglteeqtqkwfkqrlaewrrseglpsecr svtd
Timeline for d1uhsa1: