SCOPe 2.06: Domain d1uhsa1: 1uhs A:9-72

Lineage for d1uhsa1 (1uhs A:9-72)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (20 families)
   consists only of helices

5. Family a.4.1.1: Homeodomain [46690] (41 proteins)
   Pfam PF00046

6. Protein Homeodomain-only protein, Hop [109647] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [109648] (1 PDB entry)
   Uniprot Q8R1H0

8. Domain d1uhsa1: 1uhs A:9-72 [107853]
   Other proteins in same PDB: d1uhsa2

Details for d1uhsa1

PDB Entry: 1uhs

PDB Description: solution structure of mouse homeodomain-only protein hop

PDB Compounds: (A:) homeodomain only protein

SCOPe Domain Sequences for d1uhsa1:

Sequence; same for both SEQRES and ATOM records:

>d1uhsa1 a.4.1.1 (A:9-72) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]}
tedqveileynfnkvnkhpdpttlcliaaeaglteeqtqkwfkqrlaewrrseglpsecr
svtd

Timeline for d1uhsa1:

• d1uhsa1 first appeared in SCOP 1.69, called d1uhsa_
  
• d1uhsa1 was called d1uhsa_ in SCOPe 2.05
  
• d1uhsa1 appears in SCOPe 2.07
  
• d1uhsa1 appears in the current release, SCOPe 2.08