![]() | Class a: All alpha proteins [46456] (218 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (13 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.1: Homeodomain-like [46689] (13 families) ![]() consists only of helices |
![]() | Family a.4.1.1: Homeodomain [46690] (23 proteins) |
![]() | Protein Homeodomain-only protein, Hop [109647] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [109648] (1 PDB entry) |
![]() | Domain d1uhsa_: 1uhs A: [107853] |
PDB Entry: 1uhs (more details)
SCOP Domain Sequences for d1uhsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus)} gsegaatmtedqveileynfnkvnkhpdpttlcliaaeaglteeqtqkwfkqrlaewrrs eglpsecrsvtd
Timeline for d1uhsa_: