SCOP 1.73: Domain d1uhra_: 1uhr A:

Lineage for d1uhra_ (1uhr A:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.42: SWIB/MDM2 domain [47591] (1 superfamily)
   core: 4 helices: open bundle; capped by two small 3-stranded beta-sheets
   duplication: consists of two structural repeats

4. Superfamily a.42.1: SWIB/MDM2 domain [47592] (1 family)
   binds to the transactivation domain of human p53

5. Family a.42.1.1: SWIB/MDM2 domain [47593] (4 proteins)
   Pfam PF02201

6. Protein SWI/SNF related regulator of chromatin (BRG1-associated factor 60a) [109832] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [109833] (1 PDB entry)

8. Domain d1uhra_: 1uhr A: [107852]
   Structural genomics target

Details for d1uhra_

PDB Entry: 1uhr

PDB Description: solution structure of the swib domain of mouse brg1-associated factor 60a

PDB Compounds: (A:) SWI/SNF related, matrix associated, actin dependent regulator of chromatin subfamily D member 1

SCOP Domain Sequences for d1uhra_:

Sequence; same for both SEQRES and ATOM records:

>d1uhra_ a.42.1.1 (A:) SWI/SNF related regulator of chromatin (BRG1-associated factor 60a) {Mouse (Mus musculus) [TaxId: 10090]}
gssgssgqppqfkldprlarllgihtqtrpviiqalwqyikthklqdpherefvlcdkyl
qqifesqrmkfseipqrlhallmppepsgpssg

Timeline for d1uhra_:

• d1uhra_ first appeared in SCOP 1.69
  
• d1uhra_ appears in SCOP 1.71
  
• d1uhra_ appears in SCOP 1.75
  
• d1uhra_ appears in the current release, SCOPe 2.08, called d1uhra1