SCOPe 2.08: Domain d1uhra1: 1uhr A:8-87

Lineage for d1uhra1 (1uhr A:8-87)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.42: SWIB/MDM2 domain [47591] (1 superfamily)
   core: 4 helices: open bundle; capped by two small 3-stranded beta-sheets
   duplication: consists of two structural repeats

4. Superfamily a.42.1: SWIB/MDM2 domain [47592] (2 families)
   binds to the transactivation domain of human p53

5. Family a.42.1.1: SWIB/MDM2 domain [47593] (5 proteins)
   Pfam PF02201

6. Protein SWI/SNF related regulator of chromatin (BRG1-associated factor 60a) [109832] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [109833] (1 PDB entry)
   Uniprot Q61466 252-331

8. Domain d1uhra1: 1uhr A:8-87 [107852]
   Other proteins in same PDB: d1uhra2, d1uhra3
   Structural genomics target

Details for d1uhra1

PDB Entry: 1uhr

PDB Description: solution structure of the swib domain of mouse brg1-associated factor 60a

PDB Compounds: (A:) SWI/SNF related, matrix associated, actin dependent regulator of chromatin subfamily D member 1

SCOPe Domain Sequences for d1uhra1:

Sequence; same for both SEQRES and ATOM records:

>d1uhra1 a.42.1.1 (A:8-87) SWI/SNF related regulator of chromatin (BRG1-associated factor 60a) {Mouse (Mus musculus) [TaxId: 10090]}
qppqfkldprlarllgihtqtrpviiqalwqyikthklqdpherefvlcdkylqqifesq
rmkfseipqrlhallmppep

Timeline for d1uhra1:

• d1uhra1 first appeared in SCOP 1.69, called d1uhra_
  
• d1uhra1 appears in SCOPe 2.07