Lineage for d1uhra1 (1uhr A:8-87)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1996222Fold a.42: SWIB/MDM2 domain [47591] (1 superfamily)
    core: 4 helices: open bundle; capped by two small 3-stranded beta-sheets
    duplication: consists of two structural repeats
  4. 1996223Superfamily a.42.1: SWIB/MDM2 domain [47592] (2 families) (S)
    binds to the transactivation domain of human p53
  5. 1996224Family a.42.1.1: SWIB/MDM2 domain [47593] (5 protein domains)
    Pfam PF02201
  6. 1996343Protein SWI/SNF related regulator of chromatin (BRG1-associated factor 60a) [109832] (1 species)
  7. 1996344Species Mouse (Mus musculus) [TaxId:10090] [109833] (1 PDB entry)
    Uniprot Q61466 252-331
  8. 1996345Domain d1uhra1: 1uhr A:8-87 [107852]
    Other proteins in same PDB: d1uhra2, d1uhra3
    Structural genomics target

Details for d1uhra1

PDB Entry: 1uhr (more details)

PDB Description: Solution structure of the SWIB domain of mouse BRG1-associated factor 60a
PDB Compounds: (A:) SWI/SNF related, matrix associated, actin dependent regulator of chromatin subfamily D member 1

SCOPe Domain Sequences for d1uhra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uhra1 a.42.1.1 (A:8-87) SWI/SNF related regulator of chromatin (BRG1-associated factor 60a) {Mouse (Mus musculus) [TaxId: 10090]}
qppqfkldprlarllgihtqtrpviiqalwqyikthklqdpherefvlcdkylqqifesq
rmkfseipqrlhallmppep

SCOPe Domain Coordinates for d1uhra1:

Click to download the PDB-style file with coordinates for d1uhra1.
(The format of our PDB-style files is described here.)

Timeline for d1uhra1: