Class b: All beta proteins [48724] (177 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (2 families) |
Family b.34.2.1: SH3-domain [50045] (40 proteins) |
Protein Intersectin 2 (KIAA1256) [101669] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [101670] (5 PDB entries) Uniprot Q9NZM3 761-841, 897-957, 982-1037, 1055-1121, 1102-1186 |
Domain d1uhfa1: 1uhf A:8-63 [107848] Other proteins in same PDB: d1uhfa2, d1uhfa3 structural genomics; third SH3 domain |
PDB Entry: 1uhf (more details)
SCOPe Domain Sequences for d1uhfa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uhfa1 b.34.2.1 (A:8-63) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} geeyialypyssvepgdltftegeeilvtqkdgewwtgsigdrsgifpsnyvkpkd
Timeline for d1uhfa1: