Lineage for d1uhfa1 (1uhf A:8-63)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2053585Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2053714Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2053715Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 2053973Protein Intersectin 2 (KIAA1256) [101669] (1 species)
  7. 2053974Species Human (Homo sapiens) [TaxId:9606] [101670] (5 PDB entries)
    Uniprot Q9NZM3 761-841, 897-957, 982-1037, 1055-1121, 1102-1186
  8. 2053976Domain d1uhfa1: 1uhf A:8-63 [107848]
    Other proteins in same PDB: d1uhfa2, d1uhfa3
    structural genomics; third SH3 domain

Details for d1uhfa1

PDB Entry: 1uhf (more details)

PDB Description: solution structure of the third sh3 domain of human intersectin 2(kiaa1256)
PDB Compounds: (A:) Intersectin 2

SCOPe Domain Sequences for d1uhfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uhfa1 b.34.2.1 (A:8-63) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]}
geeyialypyssvepgdltftegeeilvtqkdgewwtgsigdrsgifpsnyvkpkd

SCOPe Domain Coordinates for d1uhfa1:

Click to download the PDB-style file with coordinates for d1uhfa1.
(The format of our PDB-style files is described here.)

Timeline for d1uhfa1: