Class b: All beta proteins [48724] (180 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) |
Protein Trypsin(ogen) [50515] (9 species) |
Species Pig (Sus scrofa) [TaxId:9823] [50517] (34 PDB entries) Uniprot P00761 9-231 ! Uniprot P00761 |
Domain d1uhb.1: 1uhb A:,B: [107845] complexed with an auto catalyticaly produced native peptide from trypsin, chain P (Uniprot P00761 177-185) complexed with act, ca |
PDB Entry: 1uhb (more details), 2.15 Å
SCOPe Domain Sequences for d1uhb.1:
Sequence; same for both SEQRES and ATOM records: (download)
>g1uhb.1 b.47.1.2 (A:,B:) Trypsin(ogen) {Pig (Sus scrofa) [TaxId: 9823]} ivggytcaansipyqvslnsgshfcggslinsqwvvsaahcyksriqvrlgehnidvleg neqfinaakiithpnfngntldndimliklsspatlnsrvatvslprscaaagteclisg wgntkXssgssypsllqclkapvlsdssckssypgqitgnmicvgfleggkdscqgdsgg pvvcngqlqgivswgygcaqknkpgvytkvcnyvnwiqqtiaan
Timeline for d1uhb.1: