Lineage for d1uh9a_ (1uh9 A:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 466492Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 466493Superfamily b.50.1: Acid proteases [50630] (2 families) (S)
  5. 466917Family b.50.1.2: Pepsin-like [50646] (10 proteins)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 466918Protein Acid protease [50649] (9 species)
  7. 466932Species Bread mold (Rhizopus chinensis) [TaxId:4843] [50651] (8 PDB entries)
  8. 466935Domain d1uh9a_: 1uh9 A: [107844]

Details for d1uh9a_

PDB Entry: 1uh9 (more details), 2 Å

PDB Description: Crystal structure of rhizopuspepsin at pH 7.0

SCOP Domain Sequences for d1uh9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uh9a_ b.50.1.2 (A:) Acid protease {Bread mold (Rhizopus chinensis)}
agvgtvpmtdygndieyygqvtigtpgkkfnldfdtgssdlwiastlctncgsrqtkydp
nqsstyqadgrtwsisygdgssasgilakdnvnlggllikgqtielakreaasfasgpnd
gllglgfdtittvrgvktpmdnlisqglisrpifgvylgkaknggggeyifggydstkfk
gslttvpidnsrgwwgitvdratvgtstvassfdgildtgttllilpnniaasvarayga
sdngdgtytiscdtsrfkplvfsingasfqvspdslvfeefqgqciagfgygnwdfaiig
dtflknnyvvfnqgvpevqiapvae

SCOP Domain Coordinates for d1uh9a_:

Click to download the PDB-style file with coordinates for d1uh9a_.
(The format of our PDB-style files is described here.)

Timeline for d1uh9a_: