SCOPe 2.04: Domain d1uh8a_: 1uh8 A:

Lineage for d1uh8a_ (1uh8 A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.2: Pepsin-like [50646] (11 proteins)
   duplication: consists of two similar barrel domains
   N-terminal: barrel, partly opened; n*=6, S*=10

6. Protein Acid protease [50649] (9 species)

7. Species Bread mold (Rhizopus chinensis) [TaxId:4843] [50651] (8 PDB entries)
   Uniprot P06026 69-393

8. Domain d1uh8a_: 1uh8 A: [107843]

Details for d1uh8a_

PDB Entry: 1uh8, 2.3 Å

PDB Description: Crystal structure of rhizopuspepsin at pH 8.0

PDB Compounds: (A:) hizopuspepsin I

SCOPe Domain Sequences for d1uh8a_:

Sequence; same for both SEQRES and ATOM records:

>d1uh8a_ b.50.1.2 (A:) Acid protease {Bread mold (Rhizopus chinensis) [TaxId: 4843]}
agvgtvpmtdygndieyygqvtigtpgkkfnldfdtgssdlwiastlctncgsrqtkydp
nqsstyqadgrtwsisygdgssasgilakdnvnlggllikgqtielakreaasfasgpnd
gllglgfdtittvrgvktpmdnlisqglisrpifgvylgkaknggggeyifggydstkfk
gslttvpidnsrgwwgitvdratvgtstvassfdgildtgttllilpnniaasvarayga
sdngdgtytiscdtsrfkplvfsingasfqvspdslvfeefqgqciagfgygnwdfaiig
dtflknnyvvfnqgvpevqiapvae

Timeline for d1uh8a_:

• d1uh8a_ first appeared in SCOP 1.69
  
• d1uh8a_ appears in SCOPe 2.03
  
• d1uh8a_ appears in SCOPe 2.05
  
• d1uh8a_ appears in the current release, SCOPe 2.08