Lineage for d1uh7a_ (1uh7 A:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 562942Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 562943Superfamily b.50.1: Acid proteases [50630] (2 families) (S)
  5. 563392Family b.50.1.2: Pepsin-like [50646] (10 proteins)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 563393Protein Acid protease [50649] (9 species)
  7. 563407Species Bread mold (Rhizopus chinensis) [TaxId:4843] [50651] (8 PDB entries)
  8. 563411Domain d1uh7a_: 1uh7 A: [107842]

Details for d1uh7a_

PDB Entry: 1uh7 (more details), 2.1 Å

PDB Description: Crystal structure of rhizopuspepsin at pH 4.6

SCOP Domain Sequences for d1uh7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uh7a_ b.50.1.2 (A:) Acid protease {Bread mold (Rhizopus chinensis)}
agvgtvpmtdygndieyygqvtigtpgkkfnldfdtgssdlwiastlctncgsrqtkydp
nqsstyqadgrtwsisygdgssasgilakdnvnlggllikgqtielakreaasfasgpnd
gllglgfdtittvrgvktpmdnlisqglisrpifgvylgkaknggggeyifggydstkfk
gslttvpidnsrgwwgitvdratvgtstvassfdgildtgttllilpnniaasvarayga
sdngdgtytiscdtsrfkplvfsingasfqvspdslvfeefqgqciagfgygnwdfaiig
dtflknnyvvfnqgvpevqiapvae

SCOP Domain Coordinates for d1uh7a_:

Click to download the PDB-style file with coordinates for d1uh7a_.
(The format of our PDB-style files is described here.)

Timeline for d1uh7a_: