Lineage for d1uh7a_ (1uh7 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2799129Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2799130Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2800798Family b.50.1.2: Pepsin-like [50646] (11 proteins)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 2800799Protein Acid protease [50649] (9 species)
  7. 2800814Species Bread mold (Rhizopus chinensis) [TaxId:4843] [50651] (8 PDB entries)
    Uniprot P06026 69-393
  8. 2800816Domain d1uh7a_: 1uh7 A: [107842]

Details for d1uh7a_

PDB Entry: 1uh7 (more details), 2.1 Å

PDB Description: Crystal structure of rhizopuspepsin at pH 4.6
PDB Compounds: (A:) hizopuspepsin I

SCOPe Domain Sequences for d1uh7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uh7a_ b.50.1.2 (A:) Acid protease {Bread mold (Rhizopus chinensis) [TaxId: 4843]}
agvgtvpmtdygndieyygqvtigtpgkkfnldfdtgssdlwiastlctncgsrqtkydp
nqsstyqadgrtwsisygdgssasgilakdnvnlggllikgqtielakreaasfasgpnd
gllglgfdtittvrgvktpmdnlisqglisrpifgvylgkaknggggeyifggydstkfk
gslttvpidnsrgwwgitvdratvgtstvassfdgildtgttllilpnniaasvarayga
sdngdgtytiscdtsrfkplvfsingasfqvspdslvfeefqgqciagfgygnwdfaiig
dtflknnyvvfnqgvpevqiapvae

SCOPe Domain Coordinates for d1uh7a_:

Click to download the PDB-style file with coordinates for d1uh7a_.
(The format of our PDB-style files is described here.)

Timeline for d1uh7a_: