SCOPe 2.01: Domain d1ugsb_: 1ugs B:

Lineage for d1ugsb_ (1ugs B:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.4: Electron transport accessory proteins [50090] (5 families)

5. Family b.34.4.4: Nitrile hydratase beta chain [50101] (3 proteins)
   contains irregular array of helices in the N-terminal extension

6. Protein Cobalt-containing nitrile hydratase [82067] (2 species)

7. Species Pseudonocardia thermophila [TaxId:1848] [82068] (5 PDB entries)
   Uniprot Q7SID3

8. Domain d1ugsb_: 1ugs B: [107838]
   Other proteins in same PDB: d1ugsa_
   complexed with co; mutant

Details for d1ugsb_

PDB Entry: 1ugs, 2 Å

PDB Description: crystal structure of ay114t mutant of co-type nitrile hydratase

PDB Compounds: (B:) Nitrile hydratase beta subunit

SCOPe Domain Sequences for d1ugsb_:

Sequence; same for both SEQRES and ATOM records:

>d1ugsb_ b.34.4.4 (B:) Cobalt-containing nitrile hydratase {Pseudonocardia thermophila [TaxId: 1848]}
mngvydvggtdglgpinrpadepvfraewekvafamfpatfragfmgldefrfgieqmnp
aeylespyywhwirtyihhgvrtgkidleelerrtqyyrenpdaplpeheqkpeliefvn
qavygglpasrevdrppkfkegdvvrfstaspkgharraryvrgktgtvvkhhgayiypd
tagnglgecpehlytvrftaqelwgpegdpnssvyydcwepyielvdt

Timeline for d1ugsb_:

• d1ugsb_ first appeared in SCOP 1.69
  
• d1ugsb_ appears in SCOP 1.75
  
• d1ugsb_ appears in SCOPe 2.02
  
• d1ugsb_ appears in the current release, SCOPe 2.08