Lineage for d1ugsb_ (1ugs B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2783741Superfamily b.34.4: Electron transport accessory proteins [50090] (5 families) (S)
  5. 2783802Family b.34.4.4: Nitrile hydratase beta chain [50101] (3 proteins)
    contains irregular array of helices in the N-terminal extension
    automatically mapped to Pfam PF02211
  6. 2783803Protein Cobalt-containing nitrile hydratase [82067] (2 species)
  7. 2783806Species Pseudonocardia thermophila [TaxId:1848] [82068] (5 PDB entries)
    Uniprot Q7SID3
  8. 2783810Domain d1ugsb_: 1ugs B: [107838]
    Other proteins in same PDB: d1ugsa_
    complexed with co; mutant

Details for d1ugsb_

PDB Entry: 1ugs (more details), 2 Å

PDB Description: crystal structure of ay114t mutant of co-type nitrile hydratase
PDB Compounds: (B:) Nitrile hydratase beta subunit

SCOPe Domain Sequences for d1ugsb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ugsb_ b.34.4.4 (B:) Cobalt-containing nitrile hydratase {Pseudonocardia thermophila [TaxId: 1848]}
mngvydvggtdglgpinrpadepvfraewekvafamfpatfragfmgldefrfgieqmnp
aeylespyywhwirtyihhgvrtgkidleelerrtqyyrenpdaplpeheqkpeliefvn
qavygglpasrevdrppkfkegdvvrfstaspkgharraryvrgktgtvvkhhgayiypd
tagnglgecpehlytvrftaqelwgpegdpnssvyydcwepyielvdt

SCOPe Domain Coordinates for d1ugsb_:

Click to download the PDB-style file with coordinates for d1ugsb_.
(The format of our PDB-style files is described here.)

Timeline for d1ugsb_: