| Class b: All beta proteins [48724] (180 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.4: Electron transport accessory proteins [50090] (5 families) ![]() |
| Family b.34.4.4: Nitrile hydratase beta chain [50101] (3 proteins) contains irregular array of helices in the N-terminal extension automatically mapped to Pfam PF02211 |
| Protein Cobalt-containing nitrile hydratase [82067] (2 species) |
| Species Pseudonocardia thermophila [TaxId:1848] [82068] (5 PDB entries) Uniprot Q7SID3 |
| Domain d1ugsb_: 1ugs B: [107838] Other proteins in same PDB: d1ugsa_ complexed with co; mutant |
PDB Entry: 1ugs (more details), 2 Å
SCOPe Domain Sequences for d1ugsb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ugsb_ b.34.4.4 (B:) Cobalt-containing nitrile hydratase {Pseudonocardia thermophila [TaxId: 1848]}
mngvydvggtdglgpinrpadepvfraewekvafamfpatfragfmgldefrfgieqmnp
aeylespyywhwirtyihhgvrtgkidleelerrtqyyrenpdaplpeheqkpeliefvn
qavygglpasrevdrppkfkegdvvrfstaspkgharraryvrgktgtvvkhhgayiypd
tagnglgecpehlytvrftaqelwgpegdpnssvyydcwepyielvdt
Timeline for d1ugsb_: