Lineage for d1ugsa_ (1ugs A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1934013Fold d.149: Nitrile hydratase alpha chain [56208] (1 superfamily)
    4 layers a/b/b/a; inside is a sandwich of two 2-stranded beta-sheets
  4. 1934014Superfamily d.149.1: Nitrile hydratase alpha chain [56209] (2 families) (S)
    duplication: contains two structural repeats
  5. 1934015Family d.149.1.1: Nitrile hydratase alpha chain [56210] (3 proteins)
    automatically mapped to Pfam PF02979
  6. 1934016Protein Cobalt-containing nitrile hydratase [82799] (2 species)
  7. 1934019Species Pseudonocardia thermophila [TaxId:1848] [82800] (6 PDB entries)
    Uniprot Q7SID2
  8. 1934024Domain d1ugsa_: 1ugs A: [107837]
    Other proteins in same PDB: d1ugsb_
    complexed with co; mutant

Details for d1ugsa_

PDB Entry: 1ugs (more details), 2 Å

PDB Description: crystal structure of ay114t mutant of co-type nitrile hydratase
PDB Compounds: (A:) Nitrile hydratase alpha subunit

SCOPe Domain Sequences for d1ugsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ugsa_ d.149.1.1 (A:) Cobalt-containing nitrile hydratase {Pseudonocardia thermophila [TaxId: 1848]}
tenilrksdeeiqkeitarvkalesmlieqgilttsmidrmaeiyenevgphlgakvvvk
awtdpefkkrlladgteackelgigglqgedmmwventdevhhvvvctlcsctpwpvlgl
ppnwfkepqyrsrvvreprqllkeefgfevppskeikvwdsssemrfvvlpqrpagtdgw
seeelatlvtresmigvepakav

SCOPe Domain Coordinates for d1ugsa_:

Click to download the PDB-style file with coordinates for d1ugsa_.
(The format of our PDB-style files is described here.)

Timeline for d1ugsa_: