Lineage for d1ugsa_ (1ugs A:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 735651Fold d.149: Nitrile hydratase alpha chain [56208] (1 superfamily)
    4 layers a/b/b/a; inside is a sandwich of two 2-stranded beta-sheets
  4. 735652Superfamily d.149.1: Nitrile hydratase alpha chain [56209] (1 family) (S)
    duplication: contains two structural repeats
  5. 735653Family d.149.1.1: Nitrile hydratase alpha chain [56210] (2 proteins)
  6. 735654Protein Cobalt-containing nitrile hydratase [82799] (2 species)
  7. 735657Species Pseudonocardia thermophila [TaxId:1848] [82800] (5 PDB entries)
  8. 735661Domain d1ugsa_: 1ugs A: [107837]
    Other proteins in same PDB: d1ugsb_
    complexed with co; mutant

Details for d1ugsa_

PDB Entry: 1ugs (more details), 2 Å

PDB Description: Crystal structure of aY114T mutant of Co-type nitrile hydratase
PDB Compounds: (A:) Nitrile hydratase alpha subunit

SCOP Domain Sequences for d1ugsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ugsa_ d.149.1.1 (A:) Cobalt-containing nitrile hydratase {Pseudonocardia thermophila [TaxId: 1848]}
tenilrksdeeiqkeitarvkalesmlieqgilttsmidrmaeiyenevgphlgakvvvk
awtdpefkkrlladgteackelgigglqgedmmwventdevhhvvvctlcsctpwpvlgl
ppnwfkepqyrsrvvreprqllkeefgfevppskeikvwdsssemrfvvlpqrpagtdgw
seeelatlvtresmigvepakav

SCOP Domain Coordinates for d1ugsa_:

Click to download the PDB-style file with coordinates for d1ugsa_.
(The format of our PDB-style files is described here.)

Timeline for d1ugsa_: