Lineage for d1ugrb_ (1ugr B:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 461193Fold b.34: SH3-like barrel [50036] (15 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 461565Superfamily b.34.4: Electron transport accessory proteins [50090] (4 families) (S)
  5. 461587Family b.34.4.4: Nitrile hydratase beta chain [50101] (2 proteins)
    contains irregular array of helices in the N-terminal extension
  6. 461588Protein Cobalt-containing nitrile hydratase [82067] (1 species)
  7. 461589Species Pseudonocardia thermophila [TaxId:1848] [82068] (5 PDB entries)
  8. 461592Domain d1ugrb_: 1ugr B: [107836]
    Other proteins in same PDB: d1ugra_

Details for d1ugrb_

PDB Entry: 1ugr (more details), 1.8 Å

PDB Description: Crystal structure of aT109S mutant of Co-type nitrile hydratase

SCOP Domain Sequences for d1ugrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ugrb_ b.34.4.4 (B:) Cobalt-containing nitrile hydratase {Pseudonocardia thermophila}
mngvydvggtdglgpinrpadepvfraewekvafamfpatfragfmgldefrfgieqmnp
aeylespyywhwirtyihhgvrtgkidleelerrtqyyrenpdaplpeheqkpeliefvn
qavygglpasrevdrppkfkegdvvrfstaspkgharraryvrgktgtvvkhhgayiypd
tagnglgecpehlytvrftaqelwgpegdpnssvyydcwepyielvdt

SCOP Domain Coordinates for d1ugrb_:

Click to download the PDB-style file with coordinates for d1ugrb_.
(The format of our PDB-style files is described here.)

Timeline for d1ugrb_: