SCOP 1.69: Domain d1ugrb_: 1ugr B:

Lineage for d1ugrb_ (1ugr B:)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.34: SH3-like barrel [50036] (15 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.4: Electron transport accessory proteins [50090] (4 families)

5. Family b.34.4.4: Nitrile hydratase beta chain [50101] (2 proteins)
   contains irregular array of helices in the N-terminal extension

6. Protein Cobalt-containing nitrile hydratase [82067] (1 species)

7. Species Pseudonocardia thermophila [TaxId:1848] [82068] (5 PDB entries)

8. Domain d1ugrb_: 1ugr B: [107836]
   Other proteins in same PDB: d1ugra_

Details for d1ugrb_

PDB Entry: 1ugr, 1.8 Å

PDB Description: crystal structure of at109s mutant of co-type nitrile hydratase

SCOP Domain Sequences for d1ugrb_:

Sequence; same for both SEQRES and ATOM records:

>d1ugrb_ b.34.4.4 (B:) Cobalt-containing nitrile hydratase {Pseudonocardia thermophila}
mngvydvggtdglgpinrpadepvfraewekvafamfpatfragfmgldefrfgieqmnp
aeylespyywhwirtyihhgvrtgkidleelerrtqyyrenpdaplpeheqkpeliefvn
qavygglpasrevdrppkfkegdvvrfstaspkgharraryvrgktgtvvkhhgayiypd
tagnglgecpehlytvrftaqelwgpegdpnssvyydcwepyielvdt

Timeline for d1ugrb_:

• d1ugrb_ is new in SCOP 1.69
  
• d1ugrb_ appears in SCOP 1.71
  
• d1ugrb_ appears in the current release, SCOPe 2.08