Lineage for d1ugqb_ (1ugq B:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 946133Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 946680Superfamily b.34.4: Electron transport accessory proteins [50090] (5 families) (S)
  5. 946717Family b.34.4.4: Nitrile hydratase beta chain [50101] (3 proteins)
    contains irregular array of helices in the N-terminal extension
  6. 946718Protein Cobalt-containing nitrile hydratase [82067] (2 species)
  7. 946721Species Pseudonocardia thermophila [TaxId:1848] [82068] (5 PDB entries)
    Uniprot Q7SID3
  8. 946726Domain d1ugqb_: 1ugq B: [107834]
    Other proteins in same PDB: d1ugqa_

Details for d1ugqb_

PDB Entry: 1ugq (more details), 2 Å

PDB Description: Crystal structure of apoenzyme of Co-type nitrile hydratase
PDB Compounds: (B:) Nitrile hydratase beta subunit

SCOPe Domain Sequences for d1ugqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ugqb_ b.34.4.4 (B:) Cobalt-containing nitrile hydratase {Pseudonocardia thermophila [TaxId: 1848]}
mngvydvggtdglgpinrpadepvfraewekvafamfpatfragfmgldefrfgieqmnp
aeylespyywhwirtyihhgvrtgkidleelerrtqyyrenpdaplpeheqkpeliefvn
qavygglpasrevdrppkfkegdvvrfstaspkgharraryvrgktgtvvkhhgayiypd
tagnglgecpehlytvrftaqelwgpegdpnssvyydcwepyielvdt

SCOPe Domain Coordinates for d1ugqb_:

Click to download the PDB-style file with coordinates for d1ugqb_.
(The format of our PDB-style files is described here.)

Timeline for d1ugqb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ugqa_