Lineage for d1ugqa_ (1ugq A:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 875445Fold d.149: Nitrile hydratase alpha chain [56208] (1 superfamily)
    4 layers a/b/b/a; inside is a sandwich of two 2-stranded beta-sheets
  4. 875446Superfamily d.149.1: Nitrile hydratase alpha chain [56209] (1 family) (S)
    duplication: contains two structural repeats
  5. 875447Family d.149.1.1: Nitrile hydratase alpha chain [56210] (2 proteins)
  6. 875448Protein Cobalt-containing nitrile hydratase [82799] (2 species)
  7. 875451Species Pseudonocardia thermophila [TaxId:1848] [82800] (5 PDB entries)
    Uniprot Q7SID2
  8. 875455Domain d1ugqa_: 1ugq A: [107833]
    Other proteins in same PDB: d1ugqb_

Details for d1ugqa_

PDB Entry: 1ugq (more details), 2 Å

PDB Description: Crystal structure of apoenzyme of Co-type nitrile hydratase
PDB Compounds: (A:) Nitrile hydratase alpha subunit

SCOP Domain Sequences for d1ugqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ugqa_ d.149.1.1 (A:) Cobalt-containing nitrile hydratase {Pseudonocardia thermophila [TaxId: 1848]}
tenilrksdeeiqkeitarvkalesmlieqgilttsmidrmaeiyenevgphlgakvvvk
awtdpefkkrlladgteackelgigglqgedmmwventdevhhvvvctlcscypwpvlgl
ppnwfkepqyrsrvvreprqllkeefgfevppskeikvwdsssemrfvvlpqrpagtdgw
seeelatlvtresmigvepakav

SCOP Domain Coordinates for d1ugqa_:

Click to download the PDB-style file with coordinates for d1ugqa_.
(The format of our PDB-style files is described here.)

Timeline for d1ugqa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ugqb_