Lineage for d1ugpb_ (1ugp B:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 665027Fold b.34: SH3-like barrel [50036] (18 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 665462Superfamily b.34.4: Electron transport accessory proteins [50090] (4 families) (S)
  5. 665485Family b.34.4.4: Nitrile hydratase beta chain [50101] (2 proteins)
    contains irregular array of helices in the N-terminal extension
  6. 665486Protein Cobalt-containing nitrile hydratase [82067] (2 species)
  7. 665489Species Pseudonocardia thermophila [TaxId:1848] [82068] (5 PDB entries)
  8. 665490Domain d1ugpb_: 1ugp B: [107832]
    Other proteins in same PDB: d1ugpa_
    complexed with bua, co

Details for d1ugpb_

PDB Entry: 1ugp (more details), 1.63 Å

PDB Description: Crystal structure of Co-type nitrile hydratase complexed with n-butyric acid
PDB Compounds: (B:) Nitrile hydratase beta subunit

SCOP Domain Sequences for d1ugpb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ugpb_ b.34.4.4 (B:) Cobalt-containing nitrile hydratase {Pseudonocardia thermophila [TaxId: 1848]}
mngvydvggtdglgpinrpadepvfraewekvafamfpatfragfmgldefrfgieqmnp
aeylespyywhwirtyihhgvrtgkidleelerrtqyyrenpdaplpeheqkpeliefvn
qavygglpasrevdrppkfkegdvvrfstaspkgharraryvrgktgtvvkhhgayiypd
tagnglgecpehlytvrftaqelwgpegdpnssvyydcwepyielv

SCOP Domain Coordinates for d1ugpb_:

Click to download the PDB-style file with coordinates for d1ugpb_.
(The format of our PDB-style files is described here.)

Timeline for d1ugpb_: