Lineage for d1ugpa_ (1ugp A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1044346Fold d.149: Nitrile hydratase alpha chain [56208] (1 superfamily)
    4 layers a/b/b/a; inside is a sandwich of two 2-stranded beta-sheets
  4. 1044347Superfamily d.149.1: Nitrile hydratase alpha chain [56209] (1 family) (S)
    duplication: contains two structural repeats
  5. 1044348Family d.149.1.1: Nitrile hydratase alpha chain [56210] (3 proteins)
  6. 1044349Protein Cobalt-containing nitrile hydratase [82799] (2 species)
  7. 1044352Species Pseudonocardia thermophila [TaxId:1848] [82800] (5 PDB entries)
    Uniprot Q7SID2
  8. 1044353Domain d1ugpa_: 1ugp A: [107831]
    Other proteins in same PDB: d1ugpb_
    complexed with bua, co

Details for d1ugpa_

PDB Entry: 1ugp (more details), 1.63 Å

PDB Description: crystal structure of co-type nitrile hydratase complexed with n- butyric acid
PDB Compounds: (A:) Nitrile hydratase alpha subunit

SCOPe Domain Sequences for d1ugpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ugpa_ d.149.1.1 (A:) Cobalt-containing nitrile hydratase {Pseudonocardia thermophila [TaxId: 1848]}
tenilrksdeeiqkeitarvkalesmlieqgilttsmidrmaeiyenevgphlgakvvvk
awtdpefkkrlladgteackelgigglqgedmmwventdevhhvvvctlcscypwpvlgl
ppnwfkepqyrsrvvreprqllkeefgfevppskeikvwdsssemrfvvlpqrpagtdgw
seeelatlvtresmigvepakav

SCOPe Domain Coordinates for d1ugpa_:

Click to download the PDB-style file with coordinates for d1ugpa_.
(The format of our PDB-style files is described here.)

Timeline for d1ugpa_: