Lineage for d1ugpa_ (1ugp A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 512680Fold d.149: Nitrile hydratase alpha chain [56208] (1 superfamily)
    4 layers a/b/b/a; inside is a sandwich of two 2-stranded beta-sheets
  4. 512681Superfamily d.149.1: Nitrile hydratase alpha chain [56209] (1 family) (S)
    duplication: contains two structural repeats
  5. 512682Family d.149.1.1: Nitrile hydratase alpha chain [56210] (2 proteins)
  6. 512683Protein Cobalt-containing nitrile hydratase [82799] (1 species)
  7. 512684Species Pseudonocardia thermophila [TaxId:1848] [82800] (5 PDB entries)
  8. 512685Domain d1ugpa_: 1ugp A: [107831]
    Other proteins in same PDB: d1ugpb_

Details for d1ugpa_

PDB Entry: 1ugp (more details), 1.63 Å

PDB Description: Crystal structure of Co-type nitrile hydratase complexed with n-butyric acid

SCOP Domain Sequences for d1ugpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ugpa_ d.149.1.1 (A:) Cobalt-containing nitrile hydratase {Pseudonocardia thermophila}
tenilrksdeeiqkeitarvkalesmlieqgilttsmidrmaeiyenevgphlgakvvvk
awtdpefkkrlladgteackelgigglqgedmmwventdevhhvvvctlascypwpvlgl
ppnwfkepqyrsrvvreprqllkeefgfevppskeikvwdsssemrfvvlpqrpagtdgw
seeelatlvtresmigvepakav

SCOP Domain Coordinates for d1ugpa_:

Click to download the PDB-style file with coordinates for d1ugpa_.
(The format of our PDB-style files is described here.)

Timeline for d1ugpa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ugpb_