Lineage for d1ugoa1 (1ugo A:8-93)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2308817Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 2309064Superfamily a.7.7: BAG domain [63491] (1 family) (S)
  5. 2309065Family a.7.7.1: BAG domain [63492] (4 proteins)
    Pfam PF02179
  6. 2309084Protein BAG-family molecular chaperone regulator-5, BAG-5 [109745] (1 species)
  7. 2309085Species Mouse (Mus musculus) [TaxId:10090] [109746] (1 PDB entry)
    Uniprot Q8CI32 1-86
  8. 2309086Domain d1ugoa1: 1ugo A:8-93 [107830]
    Other proteins in same PDB: d1ugoa2, d1ugoa3
    Structural genomics target

Details for d1ugoa1

PDB Entry: 1ugo (more details)

PDB Description: Solution structure of the first Murine BAG domain of Bcl2-associated athanogene 5
PDB Compounds: (A:) Bcl2-associated athanogene 5

SCOPe Domain Sequences for d1ugoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ugoa1 a.7.7.1 (A:8-93) BAG-family molecular chaperone regulator-5, BAG-5 {Mouse (Mus musculus) [TaxId: 10090]}
mdmgnqhpsisrlqeiqrevkaiepqvvgfsglsddknykrleriltkqlfeidsvdteg
kgdiqqarkraaqeterllkeleqna

SCOPe Domain Coordinates for d1ugoa1:

Click to download the PDB-style file with coordinates for d1ugoa1.
(The format of our PDB-style files is described here.)

Timeline for d1ugoa1: