SCOPe 2.06: Domain d1ugma_: 1ugm A:

Lineage for d1ugma_ (1ugm A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.3: GABARAP-like [54253] (4 proteins)
   intracellular membrane trafficking and fusion proteins
   automatically mapped to Pfam PF02991

6. Protein Microtubule-associated proteins 1A/1B light chain 3B [110802] (2 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [110803] (2 PDB entries)
   Uniprot Q62625 4-116

8. Domain d1ugma_: 1ugm A: [107827]

Details for d1ugma_

PDB Entry: 1ugm, 2.05 Å

PDB Description: Crystal Structure of LC3

PDB Compounds: (A:) Microtubule-associated proteins 1A/1B light chain 3

SCOPe Domain Sequences for d1ugma_:

Sequence; same for both SEQRES and ATOM records:

>d1ugma_ d.15.1.3 (A:) Microtubule-associated proteins 1A/1B light chain 3B {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ktfkqrrsfeqrvedvrlireqhptkipviierykgekqlpvldktkflvpdhvnmseli
kiirrrlqlnanqaffllvnghsmvsvstpisevyeserdedgflymvyasqe

Timeline for d1ugma_:

• d1ugma_ first appeared in SCOP 1.69
  
• d1ugma_ appears in SCOPe 2.05
  
• d1ugma_ appears in SCOPe 2.07
  
• d1ugma_ appears in the current release, SCOPe 2.08