Lineage for d1ugma_ (1ugm A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 499486Fold d.15: beta-Grasp (ubiquitin-like) [54235] (12 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 499487Superfamily d.15.1: Ubiquitin-like [54236] (6 families) (S)
  5. 499609Family d.15.1.3: GABARAP-like [54253] (3 proteins)
    intracellular membrane trafficking and fusion proteins
  6. 499622Protein Microtubule-associated proteins 1A/1B light chain 3B [110802] (1 species)
  7. 499623Species Rat (Rattus norvegicus) [TaxId:10116] [110803] (1 PDB entry)
  8. 499624Domain d1ugma_: 1ugm A: [107827]

Details for d1ugma_

PDB Entry: 1ugm (more details), 2.05 Å

PDB Description: Crystal Structure of LC3

SCOP Domain Sequences for d1ugma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ugma_ d.15.1.3 (A:) Microtubule-associated proteins 1A/1B light chain 3B {Rat (Rattus norvegicus)}
ktfkqrrsfeqrvedvrlireqhptkipviierykgekqlpvldktkflvpdhvnmseli
kiirrrlqlnanqaffllvnghsmvsvstpisevyeserdedgflymvyasqe

SCOP Domain Coordinates for d1ugma_:

Click to download the PDB-style file with coordinates for d1ugma_.
(The format of our PDB-style files is described here.)

Timeline for d1ugma_: