![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.41: PRC-barrel domain [50345] (1 superfamily) core: barrel, partly opened; n*=5, S*=8; meander |
![]() | Superfamily b.41.1: PRC-barrel domain [50346] (5 families) ![]() |
![]() | Family b.41.1.3: RIKEN cDNA 2310057j16 protein (KIAA1543) [110202] (1 protein) contains an N-terminal alpha-haipin and other fold decorations automatically mapped to Pfam PF08683 |
![]() | Protein RIKEN cDNA 2310057j16 protein (KIAA1543) [110203] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [110204] (1 PDB entry) Uniprot Q80VC9 1112-1240 |
![]() | Domain d1ugja_: 1ugj A: [107826] Structural genomics target |
PDB Entry: 1ugj (more details)
SCOPe Domain Sequences for d1ugja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ugja_ b.41.1.3 (A:) RIKEN cDNA 2310057j16 protein (KIAA1543) {Mouse (Mus musculus) [TaxId: 10090]} gssgssgprlykepsaksnkfiihnalshcclagkvnepqknrileeiekskanhflilf rdsscqfralytlsgeteelsrlagygprtvtpamvegiykynsdrkrftqipaktmsms vdaftiqghlwqskksgpssg
Timeline for d1ugja_: