Lineage for d1ugja_ (1ugj A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1790502Fold b.41: PRC-barrel domain [50345] (1 superfamily)
    core: barrel, partly opened; n*=5, S*=8; meander
  4. 1790503Superfamily b.41.1: PRC-barrel domain [50346] (5 families) (S)
  5. 1790637Family b.41.1.3: RIKEN cDNA 2310057j16 protein (KIAA1543) [110202] (1 protein)
    contains an N-terminal alpha-haipin and other fold decorations
    automatically mapped to Pfam PF08683
  6. 1790638Protein RIKEN cDNA 2310057j16 protein (KIAA1543) [110203] (1 species)
  7. 1790639Species Mouse (Mus musculus) [TaxId:10090] [110204] (1 PDB entry)
    Uniprot Q80VC9 1112-1240
  8. 1790640Domain d1ugja_: 1ugj A: [107826]
    Structural genomics target

Details for d1ugja_

PDB Entry: 1ugj (more details)

PDB Description: solution structure of a murine hypothetical protein from riken cdna 2310057j16
PDB Compounds: (A:) RIKEN cDNA 2310057J16 protein

SCOPe Domain Sequences for d1ugja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ugja_ b.41.1.3 (A:) RIKEN cDNA 2310057j16 protein (KIAA1543) {Mouse (Mus musculus) [TaxId: 10090]}
gssgssgprlykepsaksnkfiihnalshcclagkvnepqknrileeiekskanhflilf
rdsscqfralytlsgeteelsrlagygprtvtpamvegiykynsdrkrftqipaktmsms
vdaftiqghlwqskksgpssg

SCOPe Domain Coordinates for d1ugja_:

Click to download the PDB-style file with coordinates for d1ugja_.
(The format of our PDB-style files is described here.)

Timeline for d1ugja_: