SCOP 1.69: Domain d1ugja_: 1ugj A:

Lineage for d1ugja_ (1ugj A:)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.41: PRC-barrel domain [50345] (1 superfamily)
   core: barrel, partly opened; n*=5, S*=8; meander

4. Superfamily b.41.1: PRC-barrel domain [50346] (3 families)

5. Family b.41.1.3: RIKEN cDNA 2310057j16 protein (KIAA1543) [110202] (1 protein)
   contains an N-terminal alpha-haipin and other fold decorations

6. Protein RIKEN cDNA 2310057j16 protein (KIAA1543) [110203] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [110204] (1 PDB entry)

8. Domain d1ugja_: 1ugj A: [107826]
   Structural genomics target

Details for d1ugja_

PDB Entry: 1ugj

PDB Description: solution structure of a murine hypothetical protein from riken cdna 2310057j16

SCOP Domain Sequences for d1ugja_:

Sequence; same for both SEQRES and ATOM records:

>d1ugja_ b.41.1.3 (A:) RIKEN cDNA 2310057j16 protein (KIAA1543) {Mouse (Mus musculus)}
gssgssgprlykepsaksnkfiihnalshcclagkvnepqknrileeiekskanhflilf
rdsscqfralytlsgeteelsrlagygprtvtpamvegiykynsdrkrftqipaktmsms
vdaftiqghlwqskksgpssg

Timeline for d1ugja_:

• d1ugja_ is new in SCOP 1.69
  
• d1ugja_ appears in SCOP 1.71
  
• d1ugja_ appears in the current release, SCOPe 2.08, called d1ugja1