Lineage for d1ug8a_ (1ug8 A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 505944Fold d.68: IF3-like [55199] (7 superfamilies)
    beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest
  4. 506087Superfamily d.68.7: R3H domain [82708] (1 family) (S)
    possibly lacks the N-terminal strand of the common fold
  5. 506088Family d.68.7.1: R3H domain [82709] (2 proteins)
    Pfam 01424
    predicted nucleic acid-binding domain
  6. 506089Protein Poly(A)-specific ribonuclease PARN [111030] (1 species)
  7. 506090Species Mouse (Mus musculus) [TaxId:10090] [111031] (1 PDB entry)
  8. 506091Domain d1ug8a_: 1ug8 A: [107825]
    Structural genomics target; structure of an RNA-binding domain (430-516) is also known: 1whv

Details for d1ug8a_

PDB Entry: 1ug8 (more details)

PDB Description: nmr structure of the r3h domain from poly(a)-specific ribonuclease

SCOP Domain Sequences for d1ug8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ug8a_ d.68.7.1 (A:) Poly(A)-specific ribonuclease PARN {Mouse (Mus musculus)}
gssgssgdqkkfidqviekiedflqseekrsleldpctgfqrkliyqtlswkypkgihve
tletdkkerhiviskvdeeersgpssg

SCOP Domain Coordinates for d1ug8a_:

Click to download the PDB-style file with coordinates for d1ug8a_.
(The format of our PDB-style files is described here.)

Timeline for d1ug8a_: