SCOPe 2.08: Domain d1ug8a1: 1ug8 A:8-81

Lineage for d1ug8a1 (1ug8 A:8-81)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.68: IF3-like [55199] (8 superfamilies)
   beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest

4. Superfamily d.68.7: R3H domain [82708] (1 family)
   possibly lacks the N-terminal strand of the common fold

5. Family d.68.7.1: R3H domain [82709] (4 proteins)
   Pfam PF01424; predicted nucleic acid-binding domain

6. Protein Poly(A)-specific ribonuclease PARN [111030] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [111031] (1 PDB entry)
   Uniprot Q8VDG3 162-248; structure of an RNA-binding domain (430-516) is also known: 1WHV

8. Domain d1ug8a1: 1ug8 A:8-81 [107825]
   Other proteins in same PDB: d1ug8a2, d1ug8a3
   Structural genomics target

Details for d1ug8a1

PDB Entry: 1ug8

PDB Description: nmr structure of the r3h domain from poly(a)-specific ribonuclease

PDB Compounds: (A:) Poly(A)-specific Ribonuclease

SCOPe Domain Sequences for d1ug8a1:

Sequence; same for both SEQRES and ATOM records:

>d1ug8a1 d.68.7.1 (A:8-81) Poly(A)-specific ribonuclease PARN {Mouse (Mus musculus) [TaxId: 10090]}
dqkkfidqviekiedflqseekrsleldpctgfqrkliyqtlswkypkgihvetletdkk
erhiviskvdeeer

Timeline for d1ug8a1:

• d1ug8a1 first appeared in SCOP 1.69, called d1ug8a_
  
• d1ug8a1 appears in SCOPe 2.07