![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.68: IF3-like [55199] (8 superfamilies) beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest |
![]() | Superfamily d.68.7: R3H domain [82708] (1 family) ![]() possibly lacks the N-terminal strand of the common fold |
![]() | Family d.68.7.1: R3H domain [82709] (4 proteins) Pfam PF01424; predicted nucleic acid-binding domain |
![]() | Protein Poly(A)-specific ribonuclease PARN [111030] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [111031] (1 PDB entry) Uniprot Q8VDG3 162-248; structure of an RNA-binding domain (430-516) is also known: 1WHV |
![]() | Domain d1ug8a1: 1ug8 A:8-81 [107825] Other proteins in same PDB: d1ug8a2, d1ug8a3 Structural genomics target |
PDB Entry: 1ug8 (more details)
SCOPe Domain Sequences for d1ug8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ug8a1 d.68.7.1 (A:8-81) Poly(A)-specific ribonuclease PARN {Mouse (Mus musculus) [TaxId: 10090]} dqkkfidqviekiedflqseekrsleldpctgfqrkliyqtlswkypkgihvetletdkk erhiviskvdeeer
Timeline for d1ug8a1: