Lineage for d1ug8a1 (1ug8 A:8-81)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.68: IF3-like [55199] (8 superfamilies)
    beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest
  4. Superfamily d.68.7: R3H domain [82708] (1 family) (S)
    possibly lacks the N-terminal strand of the common fold
  5. Family d.68.7.1: R3H domain [82709] (4 proteins)
    Pfam PF01424; predicted nucleic acid-binding domain
  6. Protein Poly(A)-specific ribonuclease PARN [111030] (1 species)
  7. Species Mouse (Mus musculus) [TaxId:10090] [111031] (1 PDB entry)
    Uniprot Q8VDG3 162-248; structure of an RNA-binding domain (430-516) is also known: 1WHV
  8. Domain d1ug8a1: 1ug8 A:8-81 [107825]
    Other proteins in same PDB: d1ug8a2, d1ug8a3
    Structural genomics target

Details for d1ug8a1

PDB Entry: 1ug8 (more details)

PDB Description: NMR structure of the R3H domain from Poly(A)-specific Ribonuclease
PDB Compounds: (A:) Poly(A)-specific Ribonuclease

SCOPe Domain Sequences for d1ug8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ug8a1 d.68.7.1 (A:8-81) Poly(A)-specific ribonuclease PARN {Mouse (Mus musculus) [TaxId: 10090]}
dqkkfidqviekiedflqseekrsleldpctgfqrkliyqtlswkypkgihvetletdkk
erhiviskvdeeer

SCOPe Domain Coordinates for d1ug8a1 are not available.

Timeline for d1ug8a1:

Domains from same chain:
(mouse over for more information)
d1ug8a2, d1ug8a3