SCOP 1.75: Domain d1ug7a_: 1ug7 A:

Lineage for d1ug7a_ (1ug7 A:)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.24: Domain from hypothetical 2610208m17rik protein [109779] (1 family)

5. Family a.24.24.1: Domain from hypothetical 2610208m17rik protein [109780] (1 protein)

6. Protein Domain from hypothetical 2610208m17rik protein [109781] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [109782] (1 PDB entry)
   Uniprot Q8C4Q6 1-115

8. Domain d1ug7a_: 1ug7 A: [107824]
   Structural genomics target

Details for d1ug7a_

PDB Entry: 1ug7

PDB Description: solution structure of four helical up-and-down bundle domain of the hypothetical protein 2610208m17rik similar to the protein flj12806

PDB Compounds: (A:) 2610208M17Rik protein

SCOP Domain Sequences for d1ug7a_:

Sequence; same for both SEQRES and ATOM records:

>d1ug7a_ a.24.24.1 (A:) Domain from hypothetical 2610208m17rik protein {Mouse (Mus musculus) [TaxId: 10090]}
gssgssgmsevtrsllqrwgaslrrgadfdswgqlveaideyqilarhlqkeaqaqhnns
efteeqkktigkiatclelrsaalqstqsqeefkledlkklepilkniltynkefpfdvq
pisgpssg

Timeline for d1ug7a_:

• d1ug7a_ first appeared in SCOP 1.69
  
• d1ug7a_ appears in SCOP 1.73
  
• d1ug7a_ appears in SCOPe 2.01
  
• d1ug7a_ appears in the current release, SCOPe 2.08, called d1ug7a1