SCOPe 2.05: Domain d1ug2a_: 1ug2 A:

Lineage for d1ug2a_ (1ug2 A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (20 families)
   consists only of helices

5. Family a.4.1.3: Myb/SANT domain [46739] (16 proteins)

6. Protein 2610100b20rik gene product [109649] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [109650] (1 PDB entry)
   Uniprot Q80TB4 1951-2032

8. Domain d1ug2a_: 1ug2 A: [107823]
   Structural genomics target

Details for d1ug2a_

PDB Entry: 1ug2

PDB Description: solution structure of mouse hypothetical gene (2610100b20rik) product homologous to myb dna-binding domain

PDB Compounds: (A:) 2610100B20Rik gene product

SCOPe Domain Sequences for d1ug2a_:

Sequence; same for both SEQRES and ATOM records:

>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]}
gpsgssgagalpkaseatvcannskvsstgekvvlwtreadrviltmcqeqgaqphtfsv
isqqlgnktpvevshrfrelmqlfhtacesgpssg

Timeline for d1ug2a_:

• d1ug2a_ first appeared in SCOP 1.69
  
• d1ug2a_ appears in SCOPe 2.04
  
• d1ug2a_ is called d1ug2a1 in SCOPe 2.06
  
• d1ug2a_ appears in the current release, SCOPe 2.08, called d1ug2a1