![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.1: Homeodomain-like [46689] (21 families) ![]() consists only of helices |
![]() | Family a.4.1.3: Myb/SANT domain [46739] (16 proteins) |
![]() | Protein 2610100b20rik gene product [109649] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [109650] (1 PDB entry) Uniprot Q80TB4 1951-2032 |
![]() | Domain d1ug2a1: 1ug2 A:1-89 [107823] Other proteins in same PDB: d1ug2a2 Structural genomics target has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1ug2 (more details)
SCOPe Domain Sequences for d1ug2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ug2a1 a.4.1.3 (A:1-89) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} gpsgssgagalpkaseatvcannskvsstgekvvlwtreadrviltmcqeqgaqphtfsv isqqlgnktpvevshrfrelmqlfhtace
Timeline for d1ug2a1: