Lineage for d1ug2a1 (1ug2 A:1-89)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2691778Superfamily a.4.1: Homeodomain-like [46689] (21 families) (S)
    consists only of helices
  5. 2692037Family a.4.1.3: Myb/SANT domain [46739] (16 proteins)
  6. 2692038Protein 2610100b20rik gene product [109649] (1 species)
  7. 2692039Species Mouse (Mus musculus) [TaxId:10090] [109650] (1 PDB entry)
    Uniprot Q80TB4 1951-2032
  8. 2692040Domain d1ug2a1: 1ug2 A:1-89 [107823]
    Other proteins in same PDB: d1ug2a2
    Structural genomics target
    has additional insertions and/or extensions that are not grouped together

Details for d1ug2a1

PDB Entry: 1ug2 (more details)

PDB Description: solution structure of mouse hypothetical gene (2610100b20rik) product homologous to myb dna-binding domain
PDB Compounds: (A:) 2610100B20Rik gene product

SCOPe Domain Sequences for d1ug2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ug2a1 a.4.1.3 (A:1-89) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]}
gpsgssgagalpkaseatvcannskvsstgekvvlwtreadrviltmcqeqgaqphtfsv
isqqlgnktpvevshrfrelmqlfhtace

SCOPe Domain Coordinates for d1ug2a1:

Click to download the PDB-style file with coordinates for d1ug2a1.
(The format of our PDB-style files is described here.)

Timeline for d1ug2a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ug2a2