SCOP 1.71: Domain d1ug0a_: 1ug0 A:

Lineage for d1ug0a_ (1ug0 A:)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.217: Surp module (SWAP domain) [109904] (1 superfamily)
   5 helices: irregular array

4. Superfamily a.217.1: Surp module (SWAP domain) [109905] (1 family)

5. Family a.217.1.1: Surp module (SWAP domain) [109906] (1 protein)
   Pfam 01805

6. Protein Splicing factor 4 [109907] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [109908] (1 PDB entry)

8. Domain d1ug0a_: 1ug0 A: [107822]
   Structural genomics target

Details for d1ug0a_

PDB Entry: 1ug0

PDB Description: solution structure of surp domain in bab30904

SCOP Domain Sequences for d1ug0a_:

Sequence; same for both SEQRES and ATOM records:

>d1ug0a_ a.217.1.1 (A:) Splicing factor 4 {Mouse (Mus musculus)}
gssgssgeedyeqwleikvsppegaetrrvieklarfvaeggpelekvamedykdnpaft
flhdknsreflyyrrkvaeirksgpssg

Timeline for d1ug0a_:

• d1ug0a_ first appeared in SCOP 1.69
  
• d1ug0a_ appears in SCOP 1.73
  
• d1ug0a_ appears in the current release, SCOPe 2.08, called d1ug0a1