Lineage for d1ug0a_ (1ug0 A:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 450693Fold a.217: Surp module (SWAP domain; Pfam 01805) [109904] (1 superfamily)
    5 helices: irregular array
  4. 450694Superfamily a.217.1: Surp module (SWAP domain; Pfam 01805) [109905] (1 family) (S)
  5. 450695Family a.217.1.1: Surp module (SWAP domain; Pfam 01805) [109906] (1 protein)
  6. 450696Protein Splicing factor 4 [109907] (1 species)
  7. 450697Species Mouse (Mus musculus) [TaxId:10090] [109908] (1 PDB entry)
  8. 450698Domain d1ug0a_: 1ug0 A: [107822]
    Structural genomics target

Details for d1ug0a_

PDB Entry: 1ug0 (more details)

PDB Description: solution structure of surp domain in bab30904

SCOP Domain Sequences for d1ug0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ug0a_ a.217.1.1 (A:) Splicing factor 4 {Mouse (Mus musculus)}
gssgssgeedyeqwleikvsppegaetrrvieklarfvaeggpelekvamedykdnpaft
flhdknsreflyyrrkvaeirksgpssg

SCOP Domain Coordinates for d1ug0a_:

Click to download the PDB-style file with coordinates for d1ug0a_.
(The format of our PDB-style files is described here.)

Timeline for d1ug0a_: