SCOPe 2.08: Domain d1ug0a1: 1ug0 A:8-82

Lineage for d1ug0a1 (1ug0 A:8-82)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.217: Surp module (SWAP domain) [109904] (1 superfamily)
   5 helices: irregular array

4. Superfamily a.217.1: Surp module (SWAP domain) [109905] (1 family)

5. Family a.217.1.1: Surp module (SWAP domain) [109906] (3 proteins)
   Pfam PF01805

6. Protein Splicing factor 4 [109907] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [109908] (2 PDB entries)
   Uniprot Q8CH02 165-239

8. Domain d1ug0a1: 1ug0 A:8-82 [107822]
   Other proteins in same PDB: d1ug0a2, d1ug0a3
   Structural genomics target

Details for d1ug0a1

PDB Entry: 1ug0

PDB Description: solution structure of surp domain in bab30904

PDB Compounds: (A:) splicing factor 4

SCOPe Domain Sequences for d1ug0a1:

Sequence; same for both SEQRES and ATOM records:

>d1ug0a1 a.217.1.1 (A:8-82) Splicing factor 4 {Mouse (Mus musculus) [TaxId: 10090]}
eedyeqwleikvsppegaetrrvieklarfvaeggpelekvamedykdnpaftflhdkns
reflyyrrkvaeirk

Timeline for d1ug0a1:

• d1ug0a1 first appeared in SCOP 1.69, called d1ug0a_
  
• d1ug0a1 appears in SCOPe 2.07