Lineage for d1ug0a1 (1ug0 A:8-82)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2015559Fold a.217: Surp module (SWAP domain) [109904] (1 superfamily)
    5 helices: irregular array
  4. 2015560Superfamily a.217.1: Surp module (SWAP domain) [109905] (1 family) (S)
  5. 2015561Family a.217.1.1: Surp module (SWAP domain) [109906] (3 protein domains)
    Pfam PF01805
  6. 2015569Protein Splicing factor 4 [109907] (1 species)
  7. 2015570Species Mouse (Mus musculus) [TaxId:10090] [109908] (2 PDB entries)
    Uniprot Q8CH02 165-239
  8. 2015572Domain d1ug0a1: 1ug0 A:8-82 [107822]
    Other proteins in same PDB: d1ug0a2, d1ug0a3
    Structural genomics target

Details for d1ug0a1

PDB Entry: 1ug0 (more details)

PDB Description: Solution structure of SURP domain in BAB30904
PDB Compounds: (A:) splicing factor 4

SCOPe Domain Sequences for d1ug0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ug0a1 a.217.1.1 (A:8-82) Splicing factor 4 {Mouse (Mus musculus) [TaxId: 10090]}
eedyeqwleikvsppegaetrrvieklarfvaeggpelekvamedykdnpaftflhdkns
reflyyrrkvaeirk

SCOPe Domain Coordinates for d1ug0a1:

Click to download the PDB-style file with coordinates for d1ug0a1.
(The format of our PDB-style files is described here.)

Timeline for d1ug0a1: