![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies) 3 helices; bundle, right-handed twist |
![]() | Superfamily a.5.9: HBS1-like domain [109732] (1 family) ![]() possibly related to UBA-like domains automatically mapped to Pfam PF08938 |
![]() | Family a.5.9.1: HBS1-like domain [109733] (1 protein) |
![]() | Protein HBS1-like protein [109734] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [109735] (1 PDB entry) Uniprot Q69ZS7 51-120 |
![]() | Domain d1ufza1: 1ufz A:8-77 [107821] Other proteins in same PDB: d1ufza2, d1ufza3 Structural genomics target |
PDB Entry: 1ufz (more details)
SCOPe Domain Sequences for d1ufza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ufza1 a.5.9.1 (A:8-77) HBS1-like protein {Mouse (Mus musculus) [TaxId: 10090]} eygyedlressnsllnhqlseidqarlyscldhmrevlgdavpddilteailkhkfdvqk alsvvleqdg
Timeline for d1ufza1: