SCOPe 2.05: Domain d1ufza_: 1ufz A:

Lineage for d1ufza_ (1ufz A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
   3 helices; bundle, right-handed twist

4. Superfamily a.5.9: HBS1-like domain [109732] (1 family)
   possibly related to UBA-like domains
   automatically mapped to Pfam PF08938

5. Family a.5.9.1: HBS1-like domain [109733] (1 protein)

6. Protein HBS1-like protein [109734] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [109735] (1 PDB entry)
   Uniprot Q69ZS7 51-120

8. Domain d1ufza_: 1ufz A: [107821]
   Structural genomics target

Details for d1ufza_

PDB Entry: 1ufz

PDB Description: solution structure of hbs1-like domain in hypothetical protein bab28515

PDB Compounds: (A:) Hypothetical protein BAB28515

SCOPe Domain Sequences for d1ufza_:

Sequence; same for both SEQRES and ATOM records:

>d1ufza_ a.5.9.1 (A:) HBS1-like protein {Mouse (Mus musculus) [TaxId: 10090]}
gssgssgeygyedlressnsllnhqlseidqarlyscldhmrevlgdavpddilteailk
hkfdvqkalsvvleqdgsgpssg

Timeline for d1ufza_:

• d1ufza_ first appeared in SCOP 1.69
  
• d1ufza_ appears in SCOPe 2.04
  
• d1ufza_ is called d1ufza1 in SCOPe 2.06
  
• d1ufza_ appears in the current release, SCOPe 2.08, called d1ufza1