Lineage for d1ufua2 (1ufu A:98-195)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2364875Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 2365143Protein Ligand binding domain of lir-1 (ilt2) [49206] (1 species)
    possibly an intermediate structure between the I set and FnIII domains
  7. 2365144Species Human (Homo sapiens) [TaxId:9606] [49207] (5 PDB entries)
    Uniprot Q8NHL6 25-218
  8. 2365154Domain d1ufua2: 1ufu A:98-195 [107820]

Details for d1ufua2

PDB Entry: 1ufu (more details), 3 Å

PDB Description: Crystal structure of ligand binding domain of immunoglobulin-like transcript 2 (ILT2; LIR-1)
PDB Compounds: (A:) Immunoglobulin-like transcript 2

SCOPe Domain Sequences for d1ufua2:

Sequence, based on SEQRES records: (download)

>d1ufua2 b.1.1.4 (A:98-195) Ligand binding domain of lir-1 (ilt2) {Human (Homo sapiens) [TaxId: 9606]}
ayikptlsaqpspvvnsggnvtlqcdsqvafdgfilckegedehpqclnsqphargssra
ifsvgpvspsrrwwyrcyaydsnspyewslpsdllell

Sequence, based on observed residues (ATOM records): (download)

>d1ufua2 b.1.1.4 (A:98-195) Ligand binding domain of lir-1 (ilt2) {Human (Homo sapiens) [TaxId: 9606]}
ayikptlsaqpspvvnsggnvtlqcdsqvafdgfilckeclnsssraifsvvwwyrcyay
dsnspyewslpsdllell

SCOPe Domain Coordinates for d1ufua2:

Click to download the PDB-style file with coordinates for d1ufua2.
(The format of our PDB-style files is described here.)

Timeline for d1ufua2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ufua1