SCOPe 2.07: Domain d1ufua1: 1ufu A:2-97

Lineage for d1ufua1 (1ufu A:2-97)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.4: I set domains [49159] (39 proteins)

6. Protein Ligand binding domain of lir-1 (ilt2) [49206] (1 species)
   possibly an intermediate structure between the I set and FnIII domains

7. Species Human (Homo sapiens) [TaxId:9606] [49207] (5 PDB entries)
   Uniprot Q8NHL6 25-218

8. Domain d1ufua1: 1ufu A:2-97 [107819]

Details for d1ufua1

PDB Entry: 1ufu, 3 Å

PDB Description: Crystal structure of ligand binding domain of immunoglobulin-like transcript 2 (ILT2; LIR-1)

PDB Compounds: (A:) Immunoglobulin-like transcript 2

SCOPe Domain Sequences for d1ufua1:

Sequence, based on SEQRES records:

>d1ufua1 b.1.1.4 (A:2-97) Ligand binding domain of lir-1 (ilt2) {Human (Homo sapiens) [TaxId: 9606]}
hlpkptlwaepgsvitqgspvtlrcqggqetqeyrlyrekktapwitripqelvkkgqfp
ipsitwehagryrcyygsdtagrsessdplelvvtg

Sequence, based on observed residues (ATOM records):

>d1ufua1 b.1.1.4 (A:2-97) Ligand binding domain of lir-1 (ilt2) {Human (Homo sapiens) [TaxId: 9606]}
hlpkptlwaepgsvitqgspvtlrcqgtqeyrlyrekktapwitripqelvkkgqfpips
itwehagryrcyygsdtagrsessdplelvvtg

Timeline for d1ufua1:

• d1ufua1 first appeared in SCOP 1.69
  
• d1ufua1 appears in SCOPe 2.06
  
• d1ufua1 appears in the current release, SCOPe 2.08