Lineage for d1ufpa_ (1ufp A:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 436026Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 436027Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 436063Family a.1.1.2: Globins [46463] (22 proteins)
    Heme-binding protein
  6. 436886Protein Myoglobin [46469] (9 species)
  7. 436959Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (151 PDB entries)
  8. 437099Domain d1ufpa_: 1ufp A: [107818]

Details for d1ufpa_

PDB Entry: 1ufp (more details), 2.1 Å

PDB Description: Crystal Structure of an Artificial Metalloprotein:Fe(III)(3,3'-Me2-salophen)/apo-wild type Myoglobin

SCOP Domain Sequences for d1ufpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ufpa_ a.1.1.2 (A:) Myoglobin {Sperm whale (Physeter catodon)}
mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
dlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
pgdfgadaqgamnkalelfrkdiaakykelgyqg

SCOP Domain Coordinates for d1ufpa_:

Click to download the PDB-style file with coordinates for d1ufpa_.
(The format of our PDB-style files is described here.)

Timeline for d1ufpa_: