SCOP 1.69: Domain d1ufpa_: 1ufp A:

Lineage for d1ufpa_ (1ufp A:)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (22 proteins)
   Heme-binding protein

6. Protein Myoglobin [46469] (9 species)

7. Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (151 PDB entries)

8. Domain d1ufpa_: 1ufp A: [107818]

Details for d1ufpa_

PDB Entry: 1ufp, 2.1 Å

PDB Description: Crystal Structure of an Artificial Metalloprotein:Fe(III)(3,3'-Me2-salophen)/apo-wild type Myoglobin

SCOP Domain Sequences for d1ufpa_:

Sequence; same for both SEQRES and ATOM records:

>d1ufpa_ a.1.1.2 (A:) Myoglobin {Sperm whale (Physeter catodon)}
mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
dlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
pgdfgadaqgamnkalelfrkdiaakykelgyqg

Timeline for d1ufpa_:

• d1ufpa_ is new in SCOP 1.69
  
• d1ufpa_ appears in SCOP 1.71
  
• d1ufpa_ appears in the current release, SCOPe 2.08