SCOP 1.69: Domain d1ufma_: 1ufm A:

Lineage for d1ufma_ (1ufm A:)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (13 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (55 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.47: PCI domain (PINT motif, Pfam 01399) [109671] (1 protein)

6. Protein COP9 signalosome complex subunit 4, GSN4 [109672] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [109673] (1 PDB entry)

8. Domain d1ufma_: 1ufm A: [107816]
   Structural genomics target

Details for d1ufma_

PDB Entry: 1ufm

PDB Description: solution structure of the pci domain

SCOP Domain Sequences for d1ufma_:

Sequence; same for both SEQRES and ATOM records:

>d1ufma_ a.4.5.47 (A:) COP9 signalosome complex subunit 4, GSN4 {Mouse (Mus musculus)}
gssgssggssildraviehnllsasklynnitfeelgalleipaakaekiasqmitegrm
ngfidqidgivhfetreasgpssg

Timeline for d1ufma_:

• d1ufma_ is new in SCOP 1.69
  
• d1ufma_ appears in SCOP 1.71
  
• d1ufma_ appears in the current release, SCOPe 2.08, called d1ufma1