Lineage for d1ufma1 (1ufm A:296-366)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2694159Family a.4.5.47: C-terminal part of PCI (proteasome COP9/signalosome eIF3) domains (PINT motif) [109671] (11 proteins)
    Pfam PF01399
    some members have long C-terminal tail with helix
  6. 2694166Protein COP9 signalosome complex subunit 4 (CSN4), C-terminal domain [109672] (1 species)
  7. 2694167Species Mouse (Mus musculus) [TaxId:10090] [109673] (1 PDB entry)
    Uniprot O88544 296-366
  8. 2694168Domain d1ufma1: 1ufm A:296-366 [107816]
    Other proteins in same PDB: d1ufma2, d1ufma3
    Structural genomics target

Details for d1ufma1

PDB Entry: 1ufm (more details)

PDB Description: solution structure of the pci domain
PDB Compounds: (A:) COP9 complex subunit 4

SCOPe Domain Sequences for d1ufma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ufma1 a.4.5.47 (A:296-366) COP9 signalosome complex subunit 4 (CSN4), C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
gssildraviehnllsasklynnitfeelgalleipaakaekiasqmitegrmngfidqi
dgivhfetrea

SCOPe Domain Coordinates for d1ufma1:

Click to download the PDB-style file with coordinates for d1ufma1.
(The format of our PDB-style files is described here.)

Timeline for d1ufma1: