![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.47: C-terminal part of PCI (proteasome COP9/signalosome eIF3) domains (PINT motif) [109671] (11 proteins) Pfam PF01399 some members have long C-terminal tail with helix |
![]() | Protein COP9 signalosome complex subunit 4 (CSN4), C-terminal domain [109672] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [109673] (1 PDB entry) Uniprot O88544 296-366 |
![]() | Domain d1ufma1: 1ufm A:296-366 [107816] Other proteins in same PDB: d1ufma2, d1ufma3 Structural genomics target |
PDB Entry: 1ufm (more details)
SCOPe Domain Sequences for d1ufma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ufma1 a.4.5.47 (A:296-366) COP9 signalosome complex subunit 4 (CSN4), C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} gssildraviehnllsasklynnitfeelgalleipaakaekiasqmitegrmngfidqi dgivhfetrea
Timeline for d1ufma1: