SCOP 1.69: Domain d1ufga_: 1ufg A:

Lineage for d1ufga_ (1ufg A:)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.16: Lamin A/C globular tail domain [74853] (1 family)

5. Family b.1.16.1: Lamin A/C globular tail domain [74854] (1 protein)

6. Protein Lamin A/C globular tail domain [74855] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [110067] (1 PDB entry)

8. Domain d1ufga_: 1ufg A: [107814]
   Structural genomics target

Details for d1ufga_

PDB Entry: 1ufg

PDB Description: solution structure of immunoglobulin like domain of mouse nuclear lamin

SCOP Domain Sequences for d1ufga_:

Sequence; same for both SEQRES and ATOM records:

>d1ufga_ b.1.16.1 (A:) Lamin A/C globular tail domain {Mouse (Mus musculus)}
gssgssgqsqgggsvtkkrklessesrssfsqhartsgrvaveevdeegkfvrlrnksne
dqsmgnwqirrqngddplmtyrfppkftlkagqvvtiwasgagathspptdlvwkaqntw
gcgsslrtalinstgeevamrklvrsgpssg

Timeline for d1ufga_:

• d1ufga_ is new in SCOP 1.69
  
• d1ufga_ appears in SCOP 1.71
  
• d1ufga_ appears in the current release, SCOPe 2.08, called d1ufga1