Lineage for d1ufga1 (1ufg A:8-145)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2764999Superfamily b.1.16: Lamin A/C globular tail domain [74853] (2 families) (S)
  5. 2765000Family b.1.16.1: Lamin A/C globular tail domain [74854] (2 proteins)
    automatically mapped to Pfam PF00932
  6. 2765001Protein Lamin A/C globular tail domain [74855] (2 species)
  7. 2765005Species Mouse (Mus musculus) [TaxId:10090] [110067] (1 PDB entry)
    Uniprot P48678 408-546
  8. 2765006Domain d1ufga1: 1ufg A:8-145 [107814]
    Other proteins in same PDB: d1ufga2, d1ufga3
    Structural genomics target

Details for d1ufga1

PDB Entry: 1ufg (more details)

PDB Description: solution structure of immunoglobulin like domain of mouse nuclear lamin
PDB Compounds: (A:) Lamin A

SCOPe Domain Sequences for d1ufga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ufga1 b.1.16.1 (A:8-145) Lamin A/C globular tail domain {Mouse (Mus musculus) [TaxId: 10090]}
qsqgggsvtkkrklessesrssfsqhartsgrvaveevdeegkfvrlrnksnedqsmgnw
qirrqngddplmtyrfppkftlkagqvvtiwasgagathspptdlvwkaqntwgcgsslr
talinstgeevamrklvr

SCOPe Domain Coordinates for d1ufga1:

Click to download the PDB-style file with coordinates for d1ufga1.
(The format of our PDB-style files is described here.)

Timeline for d1ufga1: