SCOP 1.69: Domain d1uf8a_: 1uf8 A:

Lineage for d1uf8a_ (1uf8 A:)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.160: Carbon-nitrogen hydrolase [56316] (1 superfamily)
   4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication

4. Superfamily d.160.1: Carbon-nitrogen hydrolase [56317] (2 families)
   Pfam 00795; some topological similarities to the metallo-dependent phosphatases and DNase I-like nucleases

5. Family d.160.1.2: Carbamilase [64433] (2 proteins)

6. Protein N-carbamoyl-D-aminoacid amidohydrolase [64434] (2 species)

7. Species Agrobacterium sp. [64435] (5 PDB entries)

8. Domain d1uf8a_: 1uf8 A: [107812]

Details for d1uf8a_

PDB Entry: 1uf8, 1.8 Å

PDB Description: crystal structure of c171a/v236a mutant of n-carbamyl-d-amino acid amidohydrolase complexed with n-carbamyl-d-phenylalanine

SCOP Domain Sequences for d1uf8a_:

Sequence; same for both SEQRES and ATOM records:

>d1uf8a_ d.160.1.2 (A:) N-carbamoyl-D-aminoacid amidohydrolase {Agrobacterium sp.}
trqmilavgqqgpiaraetreqvvvrlldmltkaasrganfivfpelalttffprwhftd
eaeldsfyetempgpvvrplfekaaelgigfnlgyaelvveggvkrrfntsilvdksgki
vgkyrkihlpghkeyeayrpfqhlekryfepgdlgfpvydvdaakmgmfiandrrwpeaw
rvmglrgaeiicggyntpthnppvpqhdhltsfhhllsmqagsyqngawsaaagkagmee
ncmllghscivaptgeivaltttledevitaavdldrcrelrehifnfkqhrqpqhygli
ael

Timeline for d1uf8a_:

• d1uf8a_ is new in SCOP 1.69
  
• d1uf8a_ appears in SCOP 1.71
  
• d1uf8a_ appears in the current release, SCOPe 2.08