Lineage for d1uf4a_ (1uf4 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2604424Fold d.160: Carbon-nitrogen hydrolase [56316] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 2604425Superfamily d.160.1: Carbon-nitrogen hydrolase [56317] (3 families) (S)
    Pfam PF00795; some topological similarities to the metallo-dependent phosphatases and DNase I-like nucleases
  5. 2604435Family d.160.1.2: Carbamilase [64433] (3 proteins)
  6. 2604446Protein N-carbamoyl-D-aminoacid amidohydrolase [64434] (2 species)
  7. 2604475Species Agrobacterium sp. [TaxId:361] [64435] (5 PDB entries)
    Uniprot P60327
  8. 2604484Domain d1uf4a_: 1uf4 A: [107806]
    mutant

Details for d1uf4a_

PDB Entry: 1uf4 (more details), 2.15 Å

PDB Description: crystal structure of c171a/v236a mutant of n-carbamyl-d-amino acid amidohydrolase
PDB Compounds: (A:) N-carbamyl-D-amino acid amidohydrolase

SCOPe Domain Sequences for d1uf4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uf4a_ d.160.1.2 (A:) N-carbamoyl-D-aminoacid amidohydrolase {Agrobacterium sp. [TaxId: 361]}
trqmilavgqqgpiaraetreqvvvrlldmltkaasrganfivfpelalttffprwhftd
eaeldsfyetempgpvvrplfekaaelgigfnlgyaelvveggvkrrfntsilvdksgki
vgkyrkihlpghkeyeayrpfqhlekryfepgdlgfpvydvdaakmgmfiandrrwpeaw
rvmglrgaeiicggyntpthnppvpqhdhltsfhhllsmqagsyqngawsaaagkagmee
ncmllghscivaptgeivaltttledevitaavdldrcrelrehifnfkqhrqpqhygli
ael

SCOPe Domain Coordinates for d1uf4a_:

Click to download the PDB-style file with coordinates for d1uf4a_.
(The format of our PDB-style files is described here.)

Timeline for d1uf4a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1uf4b_