Lineage for d1uf4a_ (1uf4 A:)
- Root: SCOP 1.69
Class d: Alpha and beta proteins (a+b) [53931] (279 folds) 
Fold d.160: Carbon-nitrogen hydrolase [56316] (1 superfamily)
4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplicationSuperfamily d.160.1: Carbon-nitrogen hydrolase [56317] (2 families) 
Pfam 00795; some topological similarities to the metallo-dependent phosphatases and DNase I-like nucleasesFamily d.160.1.2: Carbamilase [64433] (2 proteins) 
Protein N-carbamoyl-D-aminoacid amidohydrolase [64434] (2 species) Species Agrobacterium sp. [64435] (5 PDB entries) 
Domain d1uf4a_: 1uf4 A: [107806]
Details for d1uf4a_
PDB Entry: 1uf4 (more details), 2.15 Å
PDB Description: crystal structure of c171a/v236a mutant of n-carbamyl-d-amino acid amidohydrolase
SCOP Domain Sequences for d1uf4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uf4a_ d.160.1.2 (A:) N-carbamoyl-D-aminoacid amidohydrolase {Agrobacterium sp.}
trqmilavgqqgpiaraetreqvvvrlldmltkaasrganfivfpelalttffprwhftd
eaeldsfyetempgpvvrplfekaaelgigfnlgyaelvveggvkrrfntsilvdksgki
vgkyrkihlpghkeyeayrpfqhlekryfepgdlgfpvydvdaakmgmfiandrrwpeaw
rvmglrgaeiicggyntpthnppvpqhdhltsfhhllsmqagsyqngawsaaagkagmee
ncmllghscivaptgeivaltttledevitaavdldrcrelrehifnfkqhrqpqhygli
ael
SCOP Domain Coordinates for d1uf4a_:
Click to download the PDB-style file with coordinates for d1uf4a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1uf4a_:
- d1uf4a_ is new in SCOP 1.69
- d1uf4a_ appears in SCOP 1.71
- d1uf4a_ appears in the current release, SCOPe 2.08
View in 3D
