Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily) alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213 |
Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) automatically mapped to Pfam PF02777 |
Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins) |
Protein Cambialistic superoxide dismutase [54732] (2 species) active with either fe or mn |
Species Porphyromonas gingivalis [TaxId:837] [54734] (3 PDB entries) Uniprot P19665 |
Domain d1uesd2: 1ues D:685-791 [107805] Other proteins in same PDB: d1uesa1, d1uesb1, d1uesc1, d1uesd1 complexed with mn |
PDB Entry: 1ues (more details), 1.6 Å
SCOPe Domain Sequences for d1uesd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uesd2 d.44.1.1 (D:685-791) Cambialistic superoxide dismutase {Porphyromonas gingivalis [TaxId: 837]} kggapkgklgeaidkqfgsfekfkeefntagttlfgsgwvwlasdangklsiekepnagn pvrkglnplltfdvwehayyltyqnrradhlkdlwsivdwdivesry
Timeline for d1uesd2: