Lineage for d1uesd1 (1ues D:601-684)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1979497Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 1979785Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) (S)
    automatically mapped to Pfam PF00081
  5. 1979786Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (4 protein domains)
  6. 1979787Protein Cambialistic superoxide dismutase [46622] (2 species)
    active with either Fe or Mn
  7. 1979788Species Porphyromonas gingivalis [TaxId:837] [46624] (3 PDB entries)
    Uniprot P19665
  8. 1979796Domain d1uesd1: 1ues D:601-684 [107804]
    Other proteins in same PDB: d1uesa2, d1uesb2, d1uesc2, d1uesd2
    complexed with mn

Details for d1uesd1

PDB Entry: 1ues (more details), 1.6 Å

PDB Description: Crystal structure of Porphyromonas gingivalis SOD
PDB Compounds: (D:) superoxide dismutase

SCOPe Domain Sequences for d1uesd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uesd1 a.2.11.1 (D:601-684) Cambialistic superoxide dismutase {Porphyromonas gingivalis [TaxId: 837]}
mthelislpyavdalapvisketvefhhgkhlktyvdnlnkliigtefenadlntivqks
eggifnnagqtlnhnlyftqfrpg

SCOPe Domain Coordinates for d1uesd1:

Click to download the PDB-style file with coordinates for d1uesd1.
(The format of our PDB-style files is described here.)

Timeline for d1uesd1: