SCOPe 2.07: Domain d1uesc2: 1ues C:485-591

Lineage for d1uesc2 (1ues C:485-591)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
   alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213

4. Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families)
   automatically mapped to Pfam PF02777

5. Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins)

6. Protein Cambialistic superoxide dismutase [54732] (2 species)
   active with either fe or mn

7. Species Porphyromonas gingivalis [TaxId:837] [54734] (3 PDB entries)
   Uniprot P19665

8. Domain d1uesc2: 1ues C:485-591 [107803]
   Other proteins in same PDB: d1uesa1, d1uesb1, d1uesc1, d1uesd1
   complexed with mn

Details for d1uesc2

PDB Entry: 1ues, 1.6 Å

PDB Description: crystal structure of porphyromonas gingivalis sod

PDB Compounds: (C:) superoxide dismutase

SCOPe Domain Sequences for d1uesc2:

Sequence; same for both SEQRES and ATOM records:

>d1uesc2 d.44.1.1 (C:485-591) Cambialistic superoxide dismutase {Porphyromonas gingivalis [TaxId: 837]}
kggapkgklgeaidkqfgsfekfkeefntagttlfgsgwvwlasdangklsiekepnagn
pvrkglnplltfdvwehayyltyqnrradhlkdlwsivdwdivesry

Timeline for d1uesc2:

• d1uesc2 first appeared in SCOP 1.69
  
• d1uesc2 appears in SCOPe 2.06
  
• d1uesc2 appears in the current release, SCOPe 2.08